Pfam domain
Pfam family: GreA_GreB_N (PF03449.17)
Uniprot AC: P30128
RecName: Transcription elongation factor GreB
Begin-End: 4-74
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVR
YLTKCLENLKI
Structures of the domain P30128 4-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rin X-ray 3.7 F 4-74 None
6ri7 X-ray 3.9 G 4-74 None
6ri7 X-ray 3.9 F 4-74 None


© NPIDB team 2003 - 2021

text