Pfam domain
Pfam family: GreA_GreB (PF01272.21)
Uniprot AC: P30128
RecName: Transcription elongation factor GreB
Begin-End: 80-155
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QQEGKVFFGAWVEIENDDGVTHRFRIVGYDEIFGRKDYISIDSPMARALLKKEVGDLAVV
NTPAGEASWYVNAIEY
Structures of the domain P30128 80-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rin X-ray 3.7 F 80-155 None
6ri7 X-ray 3.9 G 80-155 None
6ri7 X-ray 3.9 F 80-155 None


© NPIDB team 2003 - 2021

text