Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P30561
RecName: Aryl hydrocarbon receptor
Begin-End: 37-79
Organism: Mus musculus
Interaction Mode:   

Sequence:
RHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAK
Structures of the domain P30561 37-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v0l X-ray 4 B 37-79  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text