Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P30665
RecName: DNA replication licensing factor MCM4
Begin-End: 191-299
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLA
YKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETK
Structures of the domain P30665 191-299
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hv9 X-ray 4.98 4 191-329 None


© NPIDB team 2003 - 2021

text