Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: P30850
RecName: Exoribonuclease 2
Begin-End: 557-636
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGET
VYKVTDVIDVTIAEVRMETR
Structures of the domain P30850 557-636
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ix1 X-ray 2.74 A 557-636 None


© NPIDB team 2003 - 2021

text