Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P30958
RecName: Transcription-repair-coupling factor
Begin-End: 602-766
Organism: Escherichia coli
Interaction Mode:   

Sequence:
TPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLL
AQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFK
DLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMA
Structures of the domain P30958 602-766
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xeo X-ray 5.5 A 602-766 None


© NPIDB team 2003 - 2021

text