Pfam domain
Pfam family: HTH_9 (PF08221.13)
Uniprot AC: P32349
RecName: DNA-directed RNA polymerase III subunit RPC3
Begin-End: 47-109
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FLYKELVKAHLGERAASVIGMLVALGRLSVRELVEKIDGMDVDSVKTTLVSLTQLRCVKY
LQE
Structures of the domain P32349 47-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 O 47-109 None
5fj8 X-ray 3.9 O 47-109 None
6cnc X-ray 4.1 O 47-109 None
6f44 X-ray 4.2 O 47-109 None
6f41 X-ray 4.3 O 47-109 None
6cnf X-ray 4.5 O 47-109 None
6eu1 X-ray 3.4 O 47-109 None
6f40 X-ray 3.7 O 47-109 None
6cnb X-ray 4.1 O 47-109 None
6f42 X-ray 5.5 O 47-109 None
6cnd X-ray 4.8 O 47-109 None


© NPIDB team 2003 - 2021

text