Pfam domain
Pfam family: Med18 (PF09637.12)
Uniprot AC: P32585
RecName: Mediator of RNA polymerase II transcription subunit 18
Begin-End: 3-299
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPN
RIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNST
NEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSM
QTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAG
NSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSR
Structures of the domain P32585 3-299
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 X 3-299 None
5oqm X-ray 5.8 e 4-299 None
5sva X-ray 15.3 Q 3-299 None


© NPIDB team 2003 - 2021

text