Pfam domain
Pfam family: SWIRM (PF04433.19)
Uniprot AC: P32591
RecName: SWI/SNF complex subunit SWI3
Begin-End: 308-393
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSYSKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTA
RRNVSGDAAALFRLHKFLTKWGLINY
Structures of the domain P32591 308-393
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uxw X-ray 8.96 E 308-393 None
6uxw X-ray 8.96 D 308-393 None


© NPIDB team 2003 - 2021

text