Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: P32591
RecName: SWI/SNF complex subunit SWI3
Begin-End: 524-569
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DENWSKEDLQKLLKGIQEFGADWYKVAKNVGNKSPEQCILRFLQLP
Structures of the domain P32591 524-569
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uxw X-ray 8.96 F 524-569 None
6uxw X-ray 8.96 G 524-569 None


© NPIDB team 2003 - 2021

text