Pfam domain
Pfam family: SWIRM-assoc_1 (PF16495.7)
Uniprot AC: P32591
RecName: SWI/SNF complex subunit SWI3
Begin-End: 658-741
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EIAISSLGYRSHIFATNEERQMNFLTNELIRLQMEKLDAKLNHLKKLEKFMELERKTLER
QQENLLIQRLNFNQNSSKIVNVLS
Structures of the domain P32591 658-741
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uxw X-ray 8.96 F 658-741 None


© NPIDB team 2003 - 2021

text