Pfam domain
Pfam family: HSA (PF07529.15)
Uniprot AC: P32597
RecName: Nuclear protein STH1/NPS1
Begin-End: 314-382
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EKRKKERNLHLQKINSIIDFIKERQSEQWSRQERCFQFGRLGASLHNQMEKDEQKRIERT
AKQRLAALK
Structures of the domain P32597 314-382
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 V 314-382 None
6kw3 X-ray 7.13 W 314-382 None
6kw5 X-ray 10.13 P 314-382 None
6v92 X-ray 20 R 309-384 None
6vz4 X-ray 3.9 K 316-382 None


© NPIDB team 2003 - 2021

text