Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P32597
RecName: Nuclear protein STH1/NPS1
Begin-End: 473-769
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTIT
NWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWA
HMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSA
KTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEK
VIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVF
Structures of the domain P32597 473-769
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 Y 473-769  L-Bb 
6kw3 X-ray 7.13 Y 473-769  H-Bb H-Mn L-Bb 
6kw5 X-ray 10.13 Q 473-769  H-Bb H-Mn L-Bb 
6tda X-ray 15 S 473-769  H-Bb 
6vz4 X-ray 3.9 K 473-769  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text