Pfam domain
Pfam family: Helicase_C (PF00271.33)
Uniprot AC: P32597
RecName: Nuclear protein STH1/NPS1
Begin-End: 791-905
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEML
NAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIG
Structures of the domain P32597 791-905
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 Y 791-905  H-Bb S-Bb L-Bb L-Mj L-Mn 
6kw3 X-ray 7.13 Y 791-905  H-Bb L-Bb L-Mj 
6kw5 X-ray 10.13 Q 791-905  L-Bb L-Mj 
6tda X-ray 15 S 791-905  L-Bb L-Mj 
6vz4 X-ray 3.9 K 791-905  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text