Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P32639
RecName: Pre-mRNA-splicing helicase BRR2
Begin-End: 1349-1520
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NKIQSQVFESLYNSNDSVFVGSGKGTGKTAMAELALLNHWRQNKGRAVYINPSGEKIDFL
LSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPVQFELLSRRWRQRKNIQSL
ELMIYDDAHEISQGVYGAVYETLISRMIFIATQLEKKIRFVCLSNCLANARD
Structures of the domain P32639 1349-1520
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 N 1349-1520 None
5gan X-ray 3.6 B 1349-1520 None
5lj5 X-ray 3.8 B 1349-1520 None
5lqw X-ray 5.8 C 1349-1520 None
5zwo X-ray 3.9 D 1349-1520 None
5gao X-ray 3.6 B 1349-1520 None


© NPIDB team 2003 - 2021

text