Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: P32657
RecName: Chromo domain-containing protein 1
Begin-End: 1173-1202
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb L-Bb 

Sequence:
SNWTKEEDEKLLIGVFKYGYGSWTQIRDDP
Structures of the domain P32657 1173-1202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ted X-ray 2 A 1172-1201  H-Bb L-Bb 
5j70 X-ray 2.96 B 1172-1201 None
5j70 X-ray 2.96 A 1172-1201 None


© NPIDB team 2003 - 2021

text