Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: P32657
RecName: Chromo domain-containing protein 1
Begin-End: 379-665
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMP
AWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKD
RAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNF
LMPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVEL
SDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLF
Structures of the domain P32657 379-665
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6g0l X-ray 10 W 379-665 None
6g0l X-ray 10 M 379-689 None
5o9g X-ray 4.8 W 379-689 None
6ftx X-ray 4.5 W 379-665 None


© NPIDB team 2003 - 2021

text