Pfam domain
Pfam family: Myb_DNA-binding (PF00249.33)
Uniprot AC: P32657
RecName: Chromo domain-containing protein 1
Begin-End: 794-823
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NPQADLQAMARAHRIGQKNHVMVYRLVSKD
Structures of the domain P32657 794-823
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6g0l X-ray 10 M 1172-1201 None
5o9g X-ray 4.8 W 1172-1201 None


© NPIDB team 2003 - 2021

text