Pfam domain
Pfam family: TFIIA (PF03153.15)
Uniprot AC: P32773
RecName: Transcription initiation factor IIA large subunit
Begin-End: 228-285
Organism: Saccharomyces cerevisiae
Interaction Mode:  S-Bb L-Bb 

Sequence:
DYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEW
Structures of the domain P32773 228-285
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rm1 X-ray 2.5 C 61-285  S-Bb L-Bb 
1nh2 X-ray 1.9 C 228-285  S-Bb L-Bb 
5fmf X-ray 6 M 61-285  S-Bb L-Bb 
5sva X-ray 15.3 d 62-158 None


© NPIDB team 2003 - 2021

text