Pfam domain
Pfam family: TFIIA (PF03153.15)
Uniprot AC: P32773
RecName: Transcription initiation factor IIA large subunit
Begin-End: 241-285
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEW
Structures of the domain P32773 241-285
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ytf X-ray 2.5 C 241-285  S-Bb 
5fyw X-ray 4.35 U 47-285  S-Bb L-Bb 
6gyk X-ray 5.1 U 47-285 None
5oqj X-ray 4.7 U 47-285  S-Bb 
5fz5 X-ray 8.8 U 47-285  S-Bb L-Bb 
5oqm X-ray 5.8 U 47-285 None
6gym X-ray 6.7 U 47-285 None
6gyl X-ray 4.8 U 47-285 None


© NPIDB team 2003 - 2021

text