Pfam domain
Pfam family: TFIIA (PF03153.15)
Uniprot AC: P32773
RecName: Transcription initiation factor IIA large subunit
Begin-End: 9-61
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFN
Structures of the domain P32773 9-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rm1 X-ray 2.5 C 9-231 None
5fmf X-ray 6 M 9-231 None
5sva X-ray 15.3 d 10-66 None


© NPIDB team 2003 - 2021

text