Pfam domain
Pfam family: TFIIA_gamma_C (PF02751.16)
Uniprot AC: P32774
RecName: Transcription initiation factor IIA subunit 2
Begin-End: 63-118
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KGNLDTYGFCDDVWTFIVKNCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNS
Structures of the domain P32774 63-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ytf X-ray 2.5 D 63-118 None
1rm1 X-ray 2.5 B 63-118 None
1nh2 X-ray 1.9 D 63-118 None
5fmf X-ray 6 O 63-118 None
5fyw X-ray 4.35 V 63-118 None
6gyk X-ray 5.1 V 63-118 None
5oqj X-ray 4.7 V 63-118 None
5fz5 X-ray 8.8 V 63-118 None
5oqm X-ray 5.8 V 63-118 None
6gym X-ray 6.7 V 63-118 None
6gyl X-ray 4.8 V 63-118 None
5sva X-ray 15.3 e 61-100 None


© NPIDB team 2003 - 2021

text