Pfam domain
Pfam family: PH_TFIIH (PF08567.13)
Uniprot AC: P32776
RecName: General transcription and DNA repair factor IIH subunit TFB1
Begin-End: 8-105
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVD
ESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQ
Structures of the domain P32776 8-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 1 8-105 None
5oqm X-ray 5.8 1 8-105 None
6gym X-ray 6.7 1 8-105 None


© NPIDB team 2003 - 2021

text