Pfam domain
Pfam family: PH_TFIIH (PF08567.13)
Uniprot AC: P32780
RecName: General transcription factor IIH subunit 1
Begin-End: 16-97
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTT
NFHFSNESTAVKERDAVKDLLQ
Structures of the domain P32780 16-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o9l X-ray 7.2 1 16-97 None


© NPIDB team 2003 - 2021

text