Pfam domain
Pfam family: Ku (PF02735.18)
Uniprot AC: P32807
RecName: ATP-dependent DNA helicase II subunit 1
Begin-End: 277-481
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYP
YGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEG
SIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIR
KFPSLLSYDDGSEHKLDYDNMKKVT
Structures of the domain P32807 277-481
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y58 X-ray 2.8 E 277-481 None
5y58 X-ray 2.8 C 277-481 None
5y58 X-ray 2.8 A 277-481 None


© NPIDB team 2003 - 2021

text