Pfam domain
Pfam family: ORC2 (PF04084.16)
Uniprot AC: P32833
RecName: Origin recognition complex subunit 2
Begin-End: 259-608
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYG
VGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKE
ITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQ
TMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKM
GKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKL
FNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAE
Structures of the domain P32833 259-608
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 B 259-607  H-Bb L-Bb L-Mj 
6wgg X-ray 8.1 B 259-607  H-Bb L-Bb 
6wgi X-ray 10 B 259-607  H-Bb L-Bb 
5v8f X-ray 3.9 B 259-607  H-Bb L-Bb 
6wgc X-ray 4.3 B 259-607  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text