Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P32899
RecName: U3 small nucleolar ribonucleoprotein protein IMP3
Begin-End: 109-156
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMED
Structures of the domain P32899 109-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6nd4 X-ray 4.3 Z 109-156 None


© NPIDB team 2003 - 2021

text