Pfam domain
Pfam family: RNA_pol_Rpc34 (PF05158.14)
Uniprot AC: P32910
RecName: DNA-directed RNA polymerase III subunit RPC6
Begin-End: 10-316
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKNLIKLVKQNDE
LKFQGVLESEAQKKATMSAEEALVYSYIEASGREGIWSKTIKARTNLHQHVVLKCLKSLE
SQRYVKSVKSVKFPTRKIYMLYSLQPSVDITGGPWFTDGELDIEFINSLLTIVWRFISEN
TFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQVANVELTPSNIRSLCEVLVY
DDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEEFSIFNYFKMFPASKHDKEV
VYFDEWT
Structures of the domain P32910 10-316
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 P 11-315 None
6cnc X-ray 4.1 P 10-294  L-Bb 
6f41 X-ray 4.3 P 11-220 None
6cnf X-ray 4.5 P 10-294  H-Bb L-Bb 
6f40 X-ray 3.7 P 11-220 None
6cnb X-ray 4.1 P 10-294 None
6cnd X-ray 4.8 P 10-294  H-Bb 


© NPIDB team 2003 - 2021

text