Pfam domain
Pfam family: RNA_pol_Rpc34 (PF05158.14)
Uniprot AC: P32910
RecName: DNA-directed RNA polymerase III subunit RPC6
Begin-End: 165-315
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FTDGELDIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEF
ITAAQVANVELTPSNIRSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKA
LEDEEEFSIFNYFKMFPASKHDKEVVYFDEW
Structures of the domain P32910 165-315
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f44 X-ray 4.2 P 188-295 None
6eu1 X-ray 3.4 P 165-315 None
6f42 X-ray 5.5 P 188-295 None


© NPIDB team 2003 - 2021

text