Pfam domain
Pfam family: RNA_pol_Rpc34 (PF05158.14)
Uniprot AC: P32910
RecName: DNA-directed RNA polymerase III subunit RPC6
Begin-End: 171-315
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQEILEFITAAQV
ANVELTPSNIRSLCEVLVYDDKLEKVTHDCYRVTLESILQMNQGEGEPEAGNKALEDEEE
FSIFNYFKMFPASKHDKEVVYFDEW
Structures of the domain P32910 171-315
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fj8 X-ray 3.9 P 187-317 None


© NPIDB team 2003 - 2021

text