Pfam domain
Pfam family: Topoisom_I (PF01028.22)
Uniprot AC: P32989
RecName: DNA topoisomerase 1
Begin-End: 73-294
Organism: Variola virus (isolate Human/India/Ind3/1967)
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj 

Sequence:
GKMHVQNRNAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFIRFG
KMKYLKENETVGLLTLKNKHIEISPDKIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDD
SSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLI
ALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSK
Structures of the domain P32989 73-294
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2h7g X-ray 1.9 X 74-294  H-Bb H-Mj H-Mn L-Bb L-Mj 
3igc X-ray 2.1 A 74-294  H-Bb H-Mj H-Mn L-Bb L-Mj 
2h7f X-ray 2.7 X 74-295  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text