Pfam domain
Pfam family: Med9 (PF07544.15)
Uniprot AC: P33308
RecName: Mediator of RNA polymerase II transcription subunit 9
Begin-End: 64-145
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EFIPHIFYSLHQIRKDPNNLSNQLETLTGSIRHRLKLCKSLISENEDTKDLLSKSPSEWQ
DIIHQREQELQIKRDVLDDLYR
Structures of the domain P33308 64-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqm X-ray 5.8 j 4-145 None
5sva X-ray 15.3 V 65-147 None


© NPIDB team 2003 - 2021

text