Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P33778
RecName: Histone H2B type 1-B
Begin-End: 34-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
EIQTAVRLL
Structures of the domain P33778 34-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3x1s X-ray 2.81 H 33-101  H-Mj S-Bb L-Bb 
3x1s X-ray 2.81 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3x1u X-ray 3.25 D 32-101  H-Bb H-Mj S-Bb L-Bb 
3x1u X-ray 3.25 H 32-101  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text