Pfam domain
Pfam family: MCM_lid (PF17855.3)
Uniprot AC: P33991
RecName: DNA replication licensing factor MCM4
Begin-End: 685-769
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAH
AKVRLSNKVEAIDVEEAKRLHREAL
Structures of the domain P33991 685-769
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 4 685-769 None


© NPIDB team 2003 - 2021

text