Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: P33992
RecName: DNA replication licensing factor MCM5
Begin-End: 136-273
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPR
KCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCD
KVVPGNRVTIMGIYSIKK
Structures of the domain P33992 136-273
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 5 136-273 None


© NPIDB team 2003 - 2021

text