Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P33992
RecName: DNA replication licensing factor MCM5
Begin-End: 318-540
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRRGDINL
LMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLA
DGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDE
TKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
Structures of the domain P33992 318-540
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 5 318-508 None


© NPIDB team 2003 - 2021

text