Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P33992
RecName: DNA replication licensing factor MCM5
Begin-End: 32-130
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQ
PAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKS
Structures of the domain P33992 32-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 5 32-130 None


© NPIDB team 2003 - 2021

text