Pfam domain
Pfam family: MCM_lid (PF17855.3)
Uniprot AC: P33992
RecName: DNA replication licensing factor MCM5
Begin-End: 557-648
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAI
VRIAEALSKMKLQPFATEADVEEALRLFQVST
Structures of the domain P33992 557-648
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 5 557-648 None


© NPIDB team 2003 - 2021

text