Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: P33993
RecName: DNA replication licensing factor MCM7
Begin-End: 10-140
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICEN
ARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAE
LMRRFELYFQG
Structures of the domain P33993 10-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 7 10-140 None


© NPIDB team 2003 - 2021

text