Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: P33993
RecName: DNA replication licensing factor MCM7
Begin-End: 320-541
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICL
MGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQ
GVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRR
SLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVH
Structures of the domain P33993 320-541
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 7 320-541 None


© NPIDB team 2003 - 2021

text