Pfam domain
Pfam family: Med20 (PF08612.13)
Uniprot AC: P34162
RecName: Mediator of RNA polymerase II transcription subunit 20
Begin-End: 2-209
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSIT
FHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQL
IKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKE
YKTSSDSLGPDTSNEICDLAYQYVRALE
Structures of the domain P34162 2-209
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 Y 3-209 None
5oqm X-ray 5.8 f 3-209 None
5sva X-ray 15.3 R 3-209 None


© NPIDB team 2003 - 2021

text