Pfam domain
Pfam family: HTH_Tnp_Tc3_1 (PF11427.10)
Uniprot AC: P34257
RecName: Transposable element Tc3 transposase
Begin-End: 3-52
Organism: Caenorhabditis elegans
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
RGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIREYLKDPVSYGTS
Structures of the domain P34257 3-52
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1u78 X-ray 2.69 A 3-52  H-Bb H-Mj L-Bb L-Mj L-Mn 
1tc3 X-ray 2.45 C 203-252  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text