Pfam domain
Pfam family: YEATS (PF03366.18)
Uniprot AC: P35189
RecName: Transcription initiation factor TFIID subunit 14
Begin-End: 27-109
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPL
DISVFLLEKAGERKIPHDLNFLQ
Structures of the domain P35189 27-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5sva X-ray 15.3 n 49-131 None


© NPIDB team 2003 - 2021

text