Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: P35716
RecName: Transcription factor SOX-11
Begin-End: 49-117
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
IKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLK
HMADYPDYK
Structures of the domain P35716 49-117
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t7c X-ray 4 L 49-117 None
6t7c X-ray 4 K 49-117  L-Bb 
6t7d X-ray 4.4 K 49-117  L-Bb 
6t7a X-ray 3.7 K 49-117  L-Bb 
6t78 X-ray 2.5 A 49-117  H-Bb H-Mj H-Mn L-Bb L-Mn 
6t78 X-ray 2.5 B 49-117  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text