Pfam domain
Pfam family: RNA_pol_Rbc25 (PF08292.14)
Uniprot AC: P35718
RecName: DNA-directed RNA polymerase III subunit RPC8
Begin-End: 83-211
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDV
NEKIRFRIEREVFVDVKPKSPKERELEERAQLENEIEGKNEETPQNEKPPAYALLGSCQT
DGMGLVSWW
Structures of the domain P35718 83-211
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 G 83-211 None
5fj8 X-ray 3.9 G 83-211 None
6cnc X-ray 4.1 G 83-211 None
6f44 X-ray 4.2 G 83-190 None
6f41 X-ray 4.3 G 83-190 None
6cnf X-ray 4.5 G 83-211 None
6eu1 X-ray 3.4 G 83-211 None
6f40 X-ray 3.7 G 83-190 None
6cnb X-ray 4.1 G 83-211 None
6f42 X-ray 5.5 G 83-190 None
6cnd X-ray 4.8 G 83-211 None


© NPIDB team 2003 - 2021

text