Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P35869
RecName: Aryl hydrocarbon receptor
Begin-End: 35-80
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAK
Structures of the domain P35869 35-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nj8 X-ray 3.3 C 36-80  H-Bb H-Mj 
5nj8 X-ray 3.3 A 36-80  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text