Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P35956
RecName: Gag-Pol polyprotein
Begin-End: 1399-1442
Organism: Maedi visna virus
Interaction Mode:   

Sequence:
FESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQSKSK
Structures of the domain P35956 1399-1442
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m0q X-ray 4.91 P 230-273 None
5m0q X-ray 4.91 L 230-273 None
5m0q X-ray 4.91 H 230-273 None
5m0q X-ray 4.91 D 230-273  L-Mj 
5m0r X-ray 8.2 P 230-273 None
5m0r X-ray 8.2 L 230-273  L-Bb L-Mj 
5m0r X-ray 8.2 H 230-273 None
5m0r X-ray 8.2 D 230-273 None


© NPIDB team 2003 - 2021

text