Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P35956
RecName: Gag-Pol polyprotein
Begin-End: 1446-1489
Organism: Maedi visna virus
Interaction Mode:   

Sequence:
IRFCYYRTRKRGHPGEWQGPTQVLWGGDGAIVVKDRGTDRYLVI
Structures of the domain P35956 1446-1489
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m0q X-ray 4.91 N 230-273 None
5m0q X-ray 4.91 F 230-273 None
5m0r X-ray 8.2 N 230-273  L-Mj 
5m0r X-ray 8.2 F 230-273  L-Mj 


© NPIDB team 2003 - 2021

text