Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P35956
RecName: Gag-Pol polyprotein
Begin-End: 1457-1500
Organism: Maedi visna virus
Interaction Mode:   

Sequence:
GHPGEWQGPTQVLWGGDGAIVVKDRGTDRYLVIANKDVKFIPPP
Structures of the domain P35956 1457-1500
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m0q X-ray 4.91 A 230-273  S-Bb S-Mn L-Mn 
5m0q X-ray 4.91 I 230-273  L-Mn 
5m0r X-ray 8.2 I 230-273 None
5m0r X-ray 8.2 A 230-273  S-Bb 


© NPIDB team 2003 - 2021

text