Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: P36048
RecName: Pre-mRNA-splicing factor SNU114
Begin-End: 6-66
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LFDEFGNLIGVDPFDSDEEESVLDEQEQYQTNTFEGSGNNNEIESRQLTSLGSKKELGIS
L
Structures of the domain P36048 6-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j6g X-ray 3.2 c 71-131 None
5wsg X-ray 4 c 13-73 None
6j6h X-ray 3.6 c 71-131 None
6j6q X-ray 3.7 c 71-131 None
5gmk X-ray 3.4 c 71-131 None
6j6n X-ray 3.86 c 71-131 None


© NPIDB team 2003 - 2021

text